PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g073690.1
Common NameMTR_3g073690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 203aa    MW: 22606.7 Da    PI: 8.7954
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g073690.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.47e-4591081100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk++rrkC+k+C++apyfp e+p+kf +vhk+FGasnv kll++++ ++reda++sl+yeAear+rdPvyG+vg+i++lq++l++l++el
  Medtr3g073690.1   9 PCAACKIQRRKCTKECIFAPYFPPENPQKFTYVHKVFGASNVAKLLNEVDASQREDAVKSLAYEAEARLRDPVYGCVGLISHLQNKLKNLQNEL 102
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++k+e
  Medtr3g073690.1 103 NVAKKE 108
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.5128109IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-449106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MMSSCNSSPC AACKIQRRKC TKECIFAPYF PPENPQKFTY VHKVFGASNV AKLLNEVDAS  60
QREDAVKSLA YEAEARLRDP VYGCVGLISH LQNKLKNLQN ELNVAKKELA TYVGPQIMLP  120
TPMTAVSSSY FSVTSSSVHQ QRQEFFTFNA ENSFSNNFQM NPFQNQLMVS SSQAQSSQPI  180
NPFLSKKVFK AERDNLGEGN LI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013460833.11e-149LOB domain protein
SwissprotQ9FKZ31e-61LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A072UZB61e-149A0A072UZB6_MEDTR; LOB domain protein
STRINGGLYMA04G11991.11e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-56ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]